Wprowadzenie do bioinformatyki

Poszukiwanie sekwencji podobnych

  • Uniwersytet Przyrodniczy we Wrocławiu
  • dr Alicja Cupiał
  • Wprowadzenie do bioinformatyki
Pobrań: 14
Wyświetleń: 980

  1  Wskazówki:  W  celach  porównawczych  przyrównania  możesz  oglądać  w  jakimś  edytorze  tekstowym  (Word, WordPad, Notatnik), programie ClustalX.   Formaty możesz zmieniać na stronie : www.ebi.ac.uk/cgi-bin/readseq.cgi  lub w ClustalX.   ...

Sprawozdanie o BLAST

  • Uniwersytet Przyrodniczy we Wrocławiu
  • dr Alicja Cupiał
  • Wprowadzenie do bioinformatyki
Pobrań: 14
Wyświetleń: 861

  1  Korzystaj z programu BLAST pod adresem : www.ncbi.nlm.nih.gov/BLAST/      1. BLink – poszukiwanie homologów już wcześniej obliczonych     gi|1173454|sp|P45897|SMA4_CAEEL Dwarfin sma-4 (MAD protein homolog 3)  MFHPGMTSQPSTSNQMYYDPLYGAEQIVQCNPMDYHQANILCGMQYFNNSHNRYPLLPQMPPQFTNDHPY  DFPNVPTISTL...

ClustalX - wprowadzenie do bioinformatyki

  • Uniwersytet Przyrodniczy we Wrocławiu
  • Wprowadzenie do bioinformatyki
Pobrań: 28
Wyświetleń: 1176

Wskazówki: W   celach   porównawczych   przyrównania   możesz   oglądać   w   jakimś   edytorze   tekstowym  (Word, WordPad, Notatnik), programie ClustalX.  Formaty możesz zmieniać na stronie:  www.ebi.ac.uk/cgi-bin/readseq.cgi l ub w ClustalX. ...

Sprawozdanie z programu BLAST

  • Uniwersytet Przyrodniczy we Wrocławiu
  • Wprowadzenie do bioinformatyki
Pobrań: 28
Wyświetleń: 721

Korzystaj z programu BLAST pod adresem:  www.ncbi.nlm.nih.gov/BLAST/ 1. BLink – poszukiwanie homologów już wcześniej obliczonych gi|1173454|sp|P45897|SMA4_CAEEL Dwarfin sma-4 (MAD protein homolog 3) MFHPGMTSQPSTSNQMYYDPLYGAEQIVQCNPMDYHQANILCGMQYFNNSHNRYPLLPQMPPQFTNDHPY DFPNVPTISTLDEASSFNGFLIPSQPS...

Align Score - wprowadzenie do informatyki

  • Uniwersytet Przyrodniczy we Wrocławiu
  • Wprowadzenie do bioinformatyki
Pobrań: 7
Wyświetleń: 805

MATCH 1 A T G C A A T G C A A C C G T T A A A C G A T MISMATCH 0 GAP OPENING -6 A T G T A T T  -  -  -  -  - C G T C A A  -  -  - A T GAP EXTENSION -1 1 1 1 0 1 0 1 -6 -1 -1 -1 -1 1 1 1 0 1 1 -6 -1 -1 1 1 Wylicz score dla przyrównania G A T A G A A A C G C A A A A T A G A A A T G C A A 0 1 1 1 1 ...

Dot Matrix - wprowadzenie do bioinformatyki

  • Uniwersytet Przyrodniczy we Wrocławiu
  • Wprowadzenie do bioinformatyki
Pobrań: 0
Wyświetleń: 749

sekwencje identyczne Arkusz 1 sekwencje podobne Arkusz 3 Arkusz 5 sekwencja z duplikacją Arkusz 2 sekwencja z inwersją Arkusz 4 W którym arkuszu znajduja się: jedna sekwencja z delecją a druga z insercją M G H N M P W A S D R T Y P W D F G V C M...

Problemy do rozwiazania

  • Uniwersytet Przyrodniczy we Wrocławiu
  • Wprowadzenie do bioinformatyki
Pobrań: 42
Wyświetleń: 938

Problemy do rozwiązania 1. Pochodzenie człowieka W   oparciu   o   podaną   sekwencję   białka   mitochondrialnego   określ   z   jakimi   małpami  człekokształtnymi   człowiek   jest   najbardziej   spokrewniony.   Przy   wyborze   sekwencji  homologicznych wybierz sekwencje należące do naczelny...


  • Uniwersytet Przyrodniczy we Wrocławiu
  • dr Alicja Cupiał
  • Wprowadzenie do bioinformatyki
Pobrań: 49
Wyświetleń: 1162

Korzystaj z programu BLAST pod adresem : www.ncbi.nlm.nih.gov/BLAST/      1. BLink – poszukiwanie homologów już wcześniej obliczonych     gi|1173454|sp|P45897|SMA4_CAEEL Dwarfin sma-4 (MAD protein homolog 3)  MFHPGMTSQPSTSNQMYYDPLYGAEQIVQCNPMDYHQANILCGMQYFNNSHNRYPLLPQMPPQFTNDHPY  DFPNVPTISTLDEASS...