Sprawozdanie o BLAST

Nasza ocena:

5
Pobrań: 14
Wyświetleń: 840
Komentarze: 0
Notatek.pl

Pobierz ten dokument za darmo

Podgląd dokumentu
Sprawozdanie o BLAST - strona 1 Sprawozdanie o BLAST - strona 2 Sprawozdanie o BLAST - strona 3

Fragment notatki:


  1  Korzystaj z programu BLAST pod adresem : www.ncbi.nlm.nih.gov/BLAST/      1. BLink – poszukiwanie homologów już wcześniej obliczonych     gi|1173454|sp|P45897|SMA4_CAEEL Dwarfin sma-4 (MAD protein homolog 3)  MFHPGMTSQPSTSNQMYYDPLYGAEQIVQCNPMDYHQANILCGMQYFNNSHNRYPLLPQMPPQFTNDHPY  DFPNVPTISTLDEASSFNGFLIPSQPSSYNNNNISCVFTPTPCTSSQASSQPPPTPTVNPTPIPPNAGAV  LTTAMDSCQQISHVLQCYQQGGEDSDFVRKAIESLVKKLKDKRIELDALITAVTSNGKQPTGCVTIQRSL  DGRLQVAGRKGVPHVVYARIWRWPKVSKNELVKLVQCQTSSDHPDNICINPYHYERVVSNRITSADQSLH  VENSPMKSEYLGDAGVIDSCSDWPNTPPDNNFNGGFAPDQPQLVTPIISDIPIDLNQIYVPTPPQLLDNW  CSIIYYELDTPIGETFKVSARDHGKVIVDGGMDPHGENEGRLCLGALSNVHRTEASEKARIHIGRGVELT  AHADGNISITSNCKIFVRSGYLDYTHGSEYSSKAHRFTPNESSFTVFDIRWAYMQMLRRSRSSNEAVRAQ  AAAVAGYAPMSVMPAIMPDSGVDRMRRDFCTIAISFVKAWGDVYQRKTIKETPCWIEVTLHRPLQILDQL  LKNSSQFGSS     Stosując  Related  information  -  BLink  znajdź  homologi  u   Xenopus    laevis   do  podanego  powyżej  białka   Caenorhabditis    elegans .  Ile  jest  tych  homologów?  Wykorzystaj  Choose  Display Options i następnie Best Hits. Zobacz przyrównanie klikając na wartość score.     130 gatunków :D      2. Czułość poszukiwań na poziomie DNA i białek oraz wielkość słów    sekA  GAATATATGAAGACCAAGATTGCAGTCCTGCTGGCCTGAGCCACGCTATTCTTGCTGTTGGTTACGGAACCGAGAATGGTAAA GACGACTGGATCATTGAGAACTCCTGGGGAGCCAGTTGGGGTGAACAAGGTTATTTCAGGCTTGCTCGTGGTAAAAAC    sekB  GAGTGTACGATGAGCCCGAGTGTAGCAGTGAAGATCTGGACCACGGTGTACTCGTTGTCGGCTATGGTGTTAAGGGTGGGAAG AAGTACTGGCTCGTCAAGAACAGCTGGGCTGAATCCTGGGGAGACCAAGGCTACATCCTTATGTCCCGTGACAACAAC    2.1.  Korzystając  z  programu  bl2seq  spróbuj  wykonać  przyrównanie  na  poziomie  nukleotydowym i aminokwasowym. W pierwszym przypadku skorzystaj z Somewhat similar  sequences  (blastn).  W  drugim  przypadku  skorzystaj  z  opcji  tblastx.  Wybierz  najmniejszą    2  wielkość  okna  jaką  się  da  (word  size  =  7  dla  sekwencji  nukleotydowych  i  2  dla  sekwencji  aminokwasowych)? Jakie są twoje wnioski?    Aminokwasy lepsze :D       2.2. Wejdź na stronę:  http://fasta.bioch.virginia.edu/fasta_www2/fasta_www.cgi?rm=compare    i  dokonaj  przyrównania  sekwencji  nukleotydowych  próbując  różne  wielkości  słów  (k-tup).  Kiedy uzyskałeś istotne przyrównanie? Co trzeba zrobić, aby znaleźć odległego homologa?    Wygrywa 3 :D       3    3. Regiony o słabej złożoności    gi|6321599|ref|NP_011675.1|  Nucleolar  protein  that  binds  nuclear  localization  sequences,  required  for  pre-rRNA  processing  and  ribosome  biogenesis;  Nsr1p  [Saccharomyces cerevisiae]  MAKTTKVKGNKKEVKASKQAKEEKAKAVSSSSSESSSSSSSSSESESESESESESSSSSSSSDSESSSSS  SSDSESEAETKKEESKDSSSSSSDSSSDEEEEEEKEETKKEESKESSSSDSSSSSSSDSESEKEESNDKK 

(…)


TGAAAAGTTTGTACGCTCCAGACATACACATATGCATATATCTAAACACATTCCCGATTTCGAAAATATT
TTAGAACTTTTAGCTTACATTCTTTGTTCTGTTTTTTTGATTTAACCCGTGTAATTATTAATTAATGAAT
AAACTTAAATGCGAAAATGTTCAA
7
Podobieństwa :D
Przeprowadź przeszukiwania bazy nr ssaków w celu znalezienia homologów do genu muszki
owocowej stosując programy MegaBLAST i discontiguous MegaBLAST. Czy są różnice w
poszukiwaniach? Z czego one wynikają?
Różniące się :D
8. Startery do PCR
>F12
GTCAAGTGGCAACTCCGTCAG
8
>R8…
…% 172..116
10. Klonowanie dinozaura i zaszyfrowane zdanie
>DinoDNA_1
GCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCGACGC
GGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCG
TGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAGCGTGGC
TGCTCACGCTGTACCTATCTCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTGGGCTGTGTG
CCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAA…
... zobacz całą notatkę

Komentarze użytkowników (0)

Zaloguj się, aby dodać komentarz